Mouse Anti-RIPPLY2 Antibody (CBMOAB-56546FYA)


Cat: CBMOAB-56546FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56546FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO56546FYA 100 µg
CBMOAB-96043FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96043FYA 100 µg
MO-AB-28510H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28510C 100 µg
MO-AB-63334W Monoclonal Marmoset WB, ELISA MO63334W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO56546FYA
SpecificityThis antibody binds to Rhesus RIPPLY2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a nuclear protein that belongs to a novel family of proteins required for vertebrate somitogenesis. Members of this family have a tetrapeptide WRPW motif that is required for interaction with the transcriptional repressor Groucho and a carboxy-terminal Ripply homology domain/Bowline-DSCR-Ledgerline conserved region required for transcriptional repression. Null mutant mice die soon after birth and display defects in axial skeleton segmentation due to defective somitogenesis. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus RIPPLY2 Antibody is a mouse antibody against RIPPLY2. It can be used for RIPPLY2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRIPPLY2
UniProt IDF7GA77
Protein RefseqThe length of the protein is 128 amino acids long.
The sequence is show below: METARGAEGTECGAAACMATDRTTRRAAADSGYAGFWRPWVDAGGKKEEETPNHAAEAMPDGPGMTAASGKLSQFRHPVRLFWPKSKCYDYLYQEAEALLKNFPIQATISFYEDSDSEDEIEELTCEN.
For Research Use Only | Not For Clinical Use.
Online Inquiry