AibGenesis™ Mouse Anti-RIT2 Antibody (MO-AB-63336W)


Cat: MO-AB-63336W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-63336W Monoclonal Marmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO63336W 100 µg
MO-AB-28513H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28513C 100 µg
MO-AB-09690Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09690Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset, Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO63336W
SpecificityThis antibody binds to Marmoset RIT2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Marmoset RIT2 Antibody is a mouse antibody against RIT2. It can be used for RIT2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGTP-binding protein Rit2 isoform 1; RIT2
UniProt IDU3FMM4
Protein RefseqThe length of the protein is 217 amino acids long.
The sequence is show below: MEVENEASCSPGSASGGSREYKVVMLGSGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKVDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDSLWKKLKGSLKKKRENMT.
See other products for " RIT2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry