Mouse Anti-RMDN1 Antibody (CBMOAB-56559FYA)


Cat: CBMOAB-56559FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56559FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO56559FYA 100 µg
CBMOAB-96061FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96061FYA 100 µg
MO-AB-07142H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07142C 100 µg
MO-AB-12532W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12532W 100 µg
MO-AB-19318R Monoclonal Cattle (Bos taurus) WB, ELISA MO19318R 100 µg
MO-AB-63341W Monoclonal Marmoset WB, ELISA MO63341W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO56559FYA
SpecificityThis antibody binds to Rhesus RMDN1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RMDN1 Antibody is a mouse antibody against RMDN1. It can be used for RMDN1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRMDN1
UniProt IDF7HIT9
Protein RefseqThe length of the protein is 314 amino acids long.
The sequence is show below: MSLAARLWRFLPLRRGAAPGPRLPAGTSGSRGHCGRCRFRGFEVMGNPGTFKRGLLLSALSYWGFETYQVISQAAVVHAAAKVEEILEQADYLYESGETEKLYQLLTQYKESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALQKNESHFAAHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIELNPKDATSIHLMGIWCYTFAEMPWYQRRIAEMLFATPPSSTYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPAHTEEDKQIQTEAAQLLTSFSEKN.
For Research Use Only | Not For Clinical Use.
Online Inquiry