Mouse Anti-RNASE1 Antibody (MO-AB-09737Y)
Cat: MO-AB-09737Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-09737Y | Monoclonal | Rabbit (Oryctolagus cuniculus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) | WB, ELISA | MO09737Y | 100 µg | ||
| MO-AB-12562W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12562W | 100 µg | ||
| MO-AB-19326R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19326R | 100 µg | ||
| MO-AB-28525H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28525C | 100 µg | ||
| MO-AB-28817R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28817R | 100 µg | ||
| MO-AB-38117W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38117W | 100 µg | ||
| MO-AB-43400W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43400W | 100 µg | ||
| MO-AB-46342W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46342W | 100 µg | ||
| MO-AB-63348W | Monoclonal | Marmoset | WB, ELISA | MO63348W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rabbit (Oryctolagus cuniculus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) |
| Clone | MO09737Y |
| Specificity | This antibody binds to Rabbit RNASE1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3''-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2'',3''-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. |
| Product Overview | This product is a mouse antibody against RNASE1. It can be used for RNASE1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Ribonuclease A C1; RAC1 |
| UniProt ID | G1ST65 |
| Protein Refseq | The length of the protein is 147 amino acids long. The sequence is show below: MALDRPLILLVLGLLMLGLAQSVLDNESPAKKFQRQHIDPKLPLSSTYCNKKMEQQDMTQGCKPLNTFVHEPLKKIQAVCFQEKVTCKDGKTNCYRSTSKMHTTDCSLLDTSKYPDCKYQTVQKERYIILACEGNPFVPVHFDASVE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry