AibGenesis™ Mouse Anti-RNF115 Antibody (CBMOAB-56591FYA)


Cat: CBMOAB-56591FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56591FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO56591FYA 100 µg
CBMOAB-96122FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96122FYA 100 µg
MO-AB-07160H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07160C 100 µg
MO-AB-11582W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11582W 100 µg
MO-AB-19350R Monoclonal Cattle (Bos taurus) WB, ELISA MO19350R 100 µg
MO-AB-63380W Monoclonal Marmoset WB, ELISA MO63380W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO56591FYA
SpecificityThis antibody binds to Rhesus RNF115.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RNF115 Antibody is a mouse antibody against RNF115. It can be used for RNF115 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNF115
UniProt IDF6V5Y8
Protein RefseqThe length of the protein is 223 amino acids long.
The sequence is show below: MFFQDFRPFLSGNPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPAIEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQSQSSEASASNRFSNDSQLHDRWTF.
For Research Use Only | Not For Clinical Use.
Online Inquiry