Mouse Anti-Rnps1 Antibody (CBMOAB-29845FYA)


Cat: CBMOAB-29845FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-29845FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO29845FYA 100 µg
CBMOAB-96266FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96266FYA 100 µg
MO-AB-15027W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15027W 100 µg
MO-AB-17491Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17491Y 100 µg
MO-AB-19418R Monoclonal Cattle (Bos taurus) WB, ELISA MO19418R 100 µg
MO-AB-43403W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43403W 100 µg
MO-AB-63458W Monoclonal Marmoset WB, ELISA MO63458W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO29845FYA
SpecificityThis antibody binds to fruit fly Rnps1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. This protein contains many serine residues. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-D. melanogaster Rnps1 Antibody is a mouse antibody against Rnps1. It can be used for Rnps1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLD23870p; RNA-binding protein S1; RnpS1; rnps1
UniProt IDQ9VHC0
Protein RefseqThe length of the protein is 374 amino acids long.
The sequence is show below: MARAQSLAGEGEKEKDNKEKVAKEKDGKATSGSSRRDRERKRRGSASSSSDSRSSTSDSSSSRSSSGSSRSSSSSSSDSSSSSSSSSSDSDRSEKNRRRGGGAAGKDKDKDKPSARSRSRSRTRSPRRVSKSPRPGSKARKEPERDRDRRSRSRDRARRAGSNDRAAADSNNVKRERSRSASRSRSPRRRGRGSVERTPPPKRRERSRSRTRSPSPKQVRIHVGRLTRNVTKDHVFEIFSSFGDVKNVEFPVDRFHPNFGRGVAFVEYATPEDCESAMKHMDGGQIDGQEITVSPVVLVKQRPPMRRPSPPMRRPQNNRWRSPPQFNRFNNRGGGGGGGGGRRQSPMRNRRSPRRRSRSPIRRRRRSNSSDSSR.
For Research Use Only | Not For Clinical Use.
Online Inquiry