AibGenesis™ Mouse Anti-Rnps1 Antibody (CBMOAB-29845FYA)
Cat: CBMOAB-29845FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-29845FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO29845FYA | 100 µg | ||
| CBMOAB-96266FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96266FYA | 100 µg | ||
| MO-AB-15027W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15027W | 100 µg | ||
| MO-AB-17491Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17491Y | 100 µg | ||
| MO-AB-19418R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19418R | 100 µg | ||
| MO-AB-43403W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43403W | 100 µg | ||
| MO-AB-63458W | Monoclonal | Marmoset | WB, ELISA | MO63458W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Hamsters (Cricetinae), Marmoset, Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO29845FYA |
| Specificity | This antibody binds to fruit fly Rnps1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. This protein contains many serine residues. Several transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-D. melanogaster Rnps1 Antibody is a mouse antibody against Rnps1. It can be used for Rnps1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | LD23870p; RNA-binding protein S1; RnpS1; rnps1 |
| UniProt ID | Q9VHC0 |
| Protein Refseq | The length of the protein is 374 amino acids long. The sequence is show below: MARAQSLAGEGEKEKDNKEKVAKEKDGKATSGSSRRDRERKRRGSASSSSDSRSSTSDSSSSRSSSGSSRSSSSSSSDSSSSSSSSSSDSDRSEKNRRRGGGAAGKDKDKDKPSARSRSRSRTRSPRRVSKSPRPGSKARKEPERDRDRRSRSRDRARRAGSNDRAAADSNNVKRERSRSASRSRSPRRRGRGSVERTPPPKRRERSRSRTRSPSPKQVRIHVGRLTRNVTKDHVFEIFSSFGDVKNVEFPVDRFHPNFGRGVAFVEYATPEDCESAMKHMDGGQIDGQEITVSPVVLVKQRPPMRRPSPPMRRPQNNRWRSPPQFNRFNNRGGGGGGGGGRRQSPMRNRRSPRRRSRSPIRRRRRSNSSDSSR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry