AibGenesis™ Mouse Anti-Roc2 Antibody (CBMOAB-29870FYA)


Cat: CBMOAB-29870FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-29870FYA Monoclonal Fruit fly (Drosophila melanogaster), Rice (Oryza) WB, ELISA MO29870FYA 100 µg
CBMOAB-89127FYB Monoclonal Rice (Oryza) WB, ELISA MO89127FYB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Rice (Oryza)
CloneMO29870FYA
SpecificityThis antibody binds to fruit fly Roc2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProbable transcription factor. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Roc2 Antibody is a mouse antibody against Roc2. It can be used for Roc2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMIP07211p; RE61847p; Roc2, isoform A; EC 6.3.2.19; Roc2, isoform B; EC 6.3.2.19; Roc2; Roc2-RA
UniProt IDQ7JWH5
Protein RefseqThe length of the protein is 113 amino acids long.
The sequence is show below: MADDPENSVDRPTDDGDAGKPEKMFTLKKWNAVAMWSWDVECDICAICRVQVMDSCLRCQADNKRDVMGRQDCVVVWGECNHSFHHCCMSLWVKQNNRCPLCQQEWSIQRMGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry