AibGenesis™ Mouse Anti-RPAIN Antibody (CBMOAB-56722FYA)


Cat: CBMOAB-56722FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56722FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO56722FYA 100 µg
CBMOAB-96355FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96355FYA 100 µg
MO-AB-05712W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05712W 100 µg
MO-AB-11855W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11855W 100 µg
MO-AB-19450R Monoclonal Cattle (Bos taurus) WB, ELISA MO19450R 100 µg
MO-AB-28574H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28574C 100 µg
MO-AB-63489W Monoclonal Marmoset WB, ELISA MO63489W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO56722FYA
SpecificityThis antibody binds to Rhesus RPAIN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RPAIN Antibody is a mouse antibody against RPAIN. It can be used for RPAIN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRPAIN
UniProt IDF7EUE7
Protein RefseqThe length of the protein is 235 amino acids long.
The sequence is show below: MPKSVSTWGRPVIQHFPEYSAIQEQSAGGNYNSQRSVRAVRGRGLRPCLPGRGDGGVFEVPPPLLVQIGGLAALERDFPAEMPGENEKQPGQAPKQVPPGWKQSARECSEHLSSARGDGRRVECFAVNGELSRRLGSVGGADRHGCAGGNSTGADRPRYNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLEGSINEHSAHCPHTPEFSVTGGTEEKSSLLMSCLACDTWAVIL.
For Research Use Only | Not For Clinical Use.
Online Inquiry