Mouse Anti-RPAP1 Antibody (MO-AB-19451R)


Cat: MO-AB-19451R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-19451R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO19451R 100 µg
CBMOAB-56726FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO56726FYA 100 µg
CBMOAB-96356FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96356FYA 100 µg
MO-AB-20321W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20321W 100 µg
MO-AB-63490W Monoclonal Marmoset WB, ELISA MO63490W 100 µg
MO-AB-07208H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07208C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO19451R
SpecificityThis antibody binds to Cattle RPAP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against RPAP1. It can be used for RPAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNA polymerase II-associated protein 1; RPAP1
UniProt IDA0JN53
Protein RefseqThe length of the protein is 1395 amino acids long.
The sequence is show below: MLSRPKPGESEVDLLRFQSQFLAAGATPAVQLVKKGSRRAGDANLEQPPLQDHRDVVMLDSLPDLPPALVPAPPKRARPSPGHLLPEHEDPEERLHRHDQHITAVLTKIIERDTSSMPVNLPVSSGVAFPPVFHRSQGRQGKPVTAGKRSIFAQEIAARRASGAKVSPVREVESILDPPESAMTCEALTPREWGSQPPWNSYSFQGPHLVTGKGLKGQEAEQEAQTIHEENVARLQALAPEEILQEQQRLLAQLD.
For Research Use Only | Not For Clinical Use.
Online Inquiry