Mouse Anti-RPGR Antibody (CBMOAB-56737FYA)


Cat: CBMOAB-56737FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56737FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis) WB, ELISA MO56737FYA 100 µg
MO-AB-05715W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05715W 100 µg
MO-AB-07214H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07214C 100 µg
MO-AB-19461R Monoclonal Cattle (Bos taurus) WB, ELISA MO19461R 100 µg
MO-AB-33114W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33114W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis)
CloneMO56737FYA
SpecificityThis antibody binds to Rhesus RPGR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein with a series of six RCC1-like domains (RLDs), characteristic of the highly conserved guanine nucleotide exchange factors. The encoded protein is found in the Golgi body and interacts with RPGRIP1. This protein localizes to the outer segment of rod photoreceptors and is essential for their viability. Mutations in this gene have been associated with X-linked retinitis pigmentosa (XLRP). Multiple alternatively spliced transcript variants that encode different isoforms of this gene have been reported, but the full-length natures of only some have been determined.
Product OverviewMouse Anti-Rhesus RPGR Antibody is a mouse antibody against RPGR. It can be used for RPGR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRPGR
UniProt IDQ56PC3
Protein RefseqThe length of the protein is 553 amino acids long.
The sequence is show below: IPEEKEGAENSKGNGIEEQEVEANEENVKVHGGRQEETEILSDDLTDKAEVSEGKAKSAGEAEDGPEGRGDGTCEEGSSGAEHWQGEEREEKGEKDKGGGEMVRPGEGEKDLAEEEEWEKRDGKEQEQKEREQGHQKERNQEMEEGEGEEEHGEGEEEEEDREEEEEKEEEKEGEGKEEGEGEAVEGEGEKEEGEVEEGEREKEERVGKEEKGEEEGDQGEGEEEGTEGEGEQKEEGGEVEEGKGEGEKEEGKGEEEEGEGEEEEEEGQGEREEEEGEEEGEEEEGEGKGEEEEGEEEGKEEEGEEGEEEEGEGKGEEEGEEGEGEGEEEEGEGEGEEEGEEEEEGEEDGEEGEGEEEGKGEEEEGEGEEEGEGEEEGEGEGEEEEGEGEEEEGEEEGEGEEEGEGEEEEGEVEGEEEGEVEGEEEGEEEGEEEGEEEEGEEEGEEKEKEGEGEENRRNREEEEEEEGKYQETGEEENERQNGEEYKKVSKMKGSVKYSKHKTYQKKLITNTQGNGKEQRSKMPVQSKQLVENGPPGSKKFWNNVLPHYLELK.
For Research Use Only | Not For Clinical Use.
Online Inquiry