Mouse Anti-Rpl11 Antibody (CBMOAB-29957FYA)
Cat: CBMOAB-29957FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-29957FYA | Monoclonal | Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Insect, Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset, Medaka (Oryzias latipes), Rhesus (Macaca mulatta), Rice (Oryza), Silkworm (Bombyx mori) | WB, ELISA | MO29957FYA | 100 µg | ||
CBMOAB-40332FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO40332FC | 100 µg | ||
CBMOAB-89146FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89146FYB | 100 µg | ||
CBMOAB-96392FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96392FYA | 100 µg | ||
MO-AB-01509R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO01509R | 100 µg | ||
MO-AB-05718W | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO05718W | 100 µg | ||
MO-AB-07219H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07219C | 100 µg | ||
MO-AB-19474R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19474R | 100 µg | ||
MO-AB-28585H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28585C | 100 µg | ||
MO-AB-28848R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28848R | 100 µg | ||
MO-AB-63506W | Monoclonal | Marmoset | WB, ELISA | MO63506W | 100 µg | ||
MO-AB-70297W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70297W | 100 µg | ||
MO-DKB-01904W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg | |||
MO-DKB-03181W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Insect, Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio) | WB, IHC, IHC-P | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Insect, Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset, Medaka (Oryzias latipes), Rhesus (Macaca mulatta), Rice (Oryza), Silkworm (Bombyx mori) |
Clone | MO29957FYA |
Specificity | This antibody binds to fruit fly Rpl11. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L5P family of ribosomal proteins. It is located in the cytoplasm. The protein probably associates with the 5S rRNA. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. (From NCBI) |
Product Overview | Mouse Anti-D. melanogaster Rpl11 Antibody is a mouse antibody against Rpl11. It can be used for Rpl11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 60S ribosomal protein L11; RpL11; RPL11A |
UniProt ID | P46222 |
Protein Refseq | The length of the protein is 184 amino acids long. The sequence is show below: MAAVTKKIKRDPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGYNVNHRKRKSGTVGFQHRLTKEDAMKWFQQKYDGIILNTKK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry