Mouse Anti-Rpl11 Antibody (CBMOAB-29957FYA)


Cat: CBMOAB-29957FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-29957FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Insect, Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset, Medaka (Oryzias latipes), Rhesus (Macaca mulatta), Rice (Oryza), Silkworm (Bombyx mori) WB, ELISA MO29957FYA 100 µg
CBMOAB-40332FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO40332FC 100 µg
CBMOAB-89146FYB Monoclonal Rice (Oryza) WB, ELISA MO89146FYB 100 µg
CBMOAB-96392FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96392FYA 100 µg
MO-AB-01509R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO01509R 100 µg
MO-AB-05718W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05718W 100 µg
MO-AB-07219H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07219C 100 µg
MO-AB-19474R Monoclonal Cattle (Bos taurus) WB, ELISA MO19474R 100 µg
MO-AB-28585H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28585C 100 µg
MO-AB-28848R Monoclonal Pig (Sus scrofa) WB, ELISA MO28848R 100 µg
MO-AB-63506W Monoclonal Marmoset WB, ELISA MO63506W 100 µg
MO-AB-70297W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70297W 100 µg
MO-DKB-01904W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
MO-DKB-03181W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Insect, Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Insect, Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio), Marmoset, Medaka (Oryzias latipes), Rhesus (Macaca mulatta), Rice (Oryza), Silkworm (Bombyx mori)
CloneMO29957FYA
SpecificityThis antibody binds to fruit fly Rpl11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L5P family of ribosomal proteins. It is located in the cytoplasm. The protein probably associates with the 5S rRNA. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Product OverviewMouse Anti-D. melanogaster Rpl11 Antibody is a mouse antibody against Rpl11. It can be used for Rpl11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names60S ribosomal protein L11; RpL11; RPL11A
UniProt IDP46222
Protein RefseqThe length of the protein is 184 amino acids long.
The sequence is show below: MAAVTKKIKRDPAKNPMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPVFSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELRRENFSSTGNFGFGIQEHIDLGIKYDPSIGIYGLDFYVVLGRPGYNVNHRKRKSGTVGFQHRLTKEDAMKWFQQKYDGIILNTKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry