AibGenesis™ Mouse Anti-RPL22L1 Antibody (CBMOAB-56757FYA)


Cat: CBMOAB-56757FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56757FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO56757FYA 100 µg
CBMOAB-96414FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96414FYA 100 µg
MO-AB-07233H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07233C 100 µg
MO-AB-19490R Monoclonal Cattle (Bos taurus) WB, ELISA MO19490R 100 µg
MO-AB-28603H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28603C 100 µg
MO-AB-63519W Monoclonal Marmoset WB, ELISA MO63519W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO56757FYA
SpecificityThis antibody binds to Rhesus RPL22L1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RPL22L1 Antibody is a mouse antibody against RPL22L1. It can be used for RPL22L1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names60S ribosomal protein L22-like 1; RPL22L1
UniProt IDH9YY36
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MAPQKDKKPKRSTWKFNLDLTHPVEDGIFDSGNFEQFLREKVKVNGKTGNLGNVVHIERFKNKITVVSEKQFSKRYLKYLTKKYLKKNNLRDWLRVVASDKETYELRYFQISQDEDESESED.
For Research Use Only | Not For Clinical Use.
Online Inquiry