Mouse Anti-RPL6 Antibody (MO-AB-33145W)
Cat: MO-AB-33145W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-33145W | Monoclonal | Dog (Canis lupus familiaris), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Silkworm (Bombyx mori), Zebrafish (Danio rerio) | WB, ELISA | MO33145W | 100 µg | ||
| CBMOAB-40461FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO40461FC | 100 µg | ||
| CBMOAB-30036FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO30036FYA | 100 µg | ||
| CBMOAB-56776FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO56776FYA | 100 µg | ||
| CBMOAB-96452FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96452FYA | 100 µg | ||
| CBMOAB-09329HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO09329HB | 100 µg | ||
| MO-AB-07903W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07903W | 100 µg | ||
| MO-AB-12052W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12052W | 100 µg | ||
| MO-AB-38734W | Monoclonal | Gorilla | WB, ELISA | MO38734W | 100 µg | ||
| MO-AB-42482W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42482W | 100 µg | ||
| MO-AB-46370W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46370W | 100 µg | ||
| MO-AB-70330W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70330W | 100 µg | ||
| MO-AB-19522R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19522R | 100 µg | ||
| MO-AB-28861R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28861R | 100 µg | ||
| MO-AB-07258H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07258C | 100 µg | ||
| MO-AB-23687H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23687C | 100 µg | ||
| MO-AB-01285L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01285L | 100 µg | ||
| MO-AB-03854Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03854Y | 100 µg | ||
| MO-AB-09761Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09761Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Dog (Canis lupus familiaris), A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Gorilla, Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Silkworm (Bombyx mori), Zebrafish (Danio rerio) |
| Clone | MO33145W |
| Specificity | This antibody binds to Dog RPL6. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein component of the 60S ribosomal subunit. This protein can bind specifically to domain C of the tax-responsive enhancer element of human T-cell leukemia virus type 1, and may participate in tax-mediated transactivation of transcription. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome. Alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-Dog RPL6 Antibody is a mouse antibody against RPL6. It can be used for RPL6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 60S ribosomal protein L6; RPL6 |
| UniProt ID | F1Q424 |
| Protein Refseq | The length of the protein is 288 amino acids long. The sequence is show below: MAGEKAEKPDTKEKKPEAKKVNAGGKAKKGNLKAKTPKKGKPHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYSAAKSRVEKKKKEKVLATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRVVFLKQLSSGLLLVTGPLALNRVPLRRTHQKFVIATSTKIDISSVKIPKHLTDAYFKKKKLRKPRHQEGEIFDTEKEKYEITEQRKVDQKAVDSQILPKIKAVPQLQGYLRSVFSLTNGVYPHKLVF. |
See other products for " RPL6 "
| MO-DKB-00720W | Rabbit Anti-RPL6 Antibody (MO-DKB-00720W) |
| MO-AB-06850Y | Mouse Anti-RPL6 Antibody (MO-AB-06850Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry