Mouse Anti-rpp25l Antibody (CBMOAB-96488FYA)


Cat: CBMOAB-96488FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-96488FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO96488FYA 100 µg
MO-AB-07270H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07270C 100 µg
MO-AB-16125W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16125W 100 µg
MO-AB-19536R Monoclonal Cattle (Bos taurus) WB, ELISA MO19536R 100 µg
MO-AB-28642H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28642C 100 µg
MO-AB-35603W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35603W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO96488FYA
SpecificityThis antibody binds to Zebrafish rpp25l.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that appears to belong to a family of evolutionarily related proteins (DUF78), that may share one or more domains in common. Members of this family are small archaebacterial proteins with no known function. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. (From NCBI)
Product OverviewMouse Anti-Zebrafish rpp25l Antibody is a mouse antibody against rpp25l. It can be used for rpp25l detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92794; rpp25l; zgc:9279
UniProt IDQ6DGS1
Protein RefseqThe length of the protein is 224 amino acids long.
The sequence is show below: MENYRKANTIEQPCPCPFPDLPSDTPEVRVKDGSKIRNLMRFALSRMEEETAASADHEGSEVSVGTGDNLCRQIVFTGVGQSVAKAITCVEIMKRRIHGLHQLTKLAYRTLQDVWEPLEPGAGLDSLTVSRNVPSIWVLLSRDSLDKNQPGYQAPGSFDALWIQALKEEAATPRHGQRRKRGGTGTGRAEVGGRGKGPRKHPGRPGDTRKPPGHAGGGQEGMNV.
For Research Use Only | Not For Clinical Use.
Online Inquiry