AibGenesis™ Mouse Anti-RPS19BP1 Antibody (CBMOAB-56823FYA)


Cat: CBMOAB-56823FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56823FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO56823FYA 100 µg
CBMOAB-96523FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96523FYA 100 µg
MO-AB-19556R Monoclonal Cattle (Bos taurus) WB, ELISA MO19556R 100 µg
MO-AB-23108W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23108W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO56823FYA
SpecificityThis antibody binds to Rhesus RPS19BP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RPS19BP1 Antibody is a mouse antibody against RPS19BP1. It can be used for RPS19BP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActive regulator of SIRT1; RPS19BP1
UniProt IDH9ZF78
Protein RefseqThe length of the protein is 137 amino acids long.
The sequence is show below: MSAALLRRGLELLAASEAPRDPPGQTKPRGAPVKRPRKTKAIQAQKLRTSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKSKKKKKAEGTVFTEEDFQKFQREYFGS.
For Research Use Only | Not For Clinical Use.
Online Inquiry