Mouse Anti-Rps2 Antibody (CBMOAB-30111FYA)
Cat: CBMOAB-30111FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-30111FYA | Monoclonal | Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Frog (Xenopus laevis), Goat (Capra hircus), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Zebrafish (Danio rerio), Rhesus (Macaca mulatta), Maize (Zea mays), Rice (Oryza), Silkworm (Bombyx mori), Sugar beet (Beta vulgaris), Yeast | WB, ELISA | MO30111FYA | 100 µg | ||
CBMOAB-96524FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96524FYA | 100 µg | ||
CBMOAB-03608CR | Monoclonal | Yeast | WB, ELISA | MO03608CR | 100 µg | ||
CBMOAB-09366HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO09366HB | 100 µg | ||
CBMOAB-89235FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89235FYB | 100 µg | ||
CBMOAB-60854FYC | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO60854FYC | 100 µg | ||
MO-AB-00567W | Monoclonal | Barrel medic (Medicago truncatula) | WB, ELISA | MO00567W | 100 µg | ||
MO-AB-38129W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38129W | 100 µg | ||
MO-AB-43408W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43408W | 100 µg | ||
MO-AB-49498W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO49498W | 100 µg | ||
MO-AB-70349W | Monoclonal | Silkworm (Bombyx mori) | WB, ELISA | MO70349W | 100 µg | ||
MO-AB-19557R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19557R | 100 µg | ||
MO-AB-07288H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07288C | 100 µg | ||
MO-AB-30531H | Monoclonal | Sugar beet (Beta vulgaris) | WB, ELISA | MO30531C | 100 µg | ||
MO-AB-01928L | Monoclonal | Bromus (Bromus vulgaris) | WB, ELISA | MO01928L | 100 µg | ||
MO-DKB-00888W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Zebrafish (Danio rerio), Rhesus (Macaca mulatta) | WB, IF, IHC | 100 µg | |||
MO-DKB-02030W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg | |||
MO-DKB-02251W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Frog (Xenopus laevis), Goat (Capra hircus), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Zebrafish (Danio rerio), Rhesus (Macaca mulatta), Maize (Zea mays), Rice (Oryza), Silkworm (Bombyx mori), Sugar beet (Beta vulgaris), Yeast |
Clone | MO30111FYA |
Specificity | This antibody binds to fruit fly Rps2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Nucleus; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S5P family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with mouse LLRep3. It is co-transcribed with the small nucleolar RNA gene U64, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Product Overview | Mouse Anti-D. melanogaster Rps2 Antibody is a mouse antibody against Rps2. It can be used for Rps2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 40S ribosomal protein S2; Protein strings of pearls; RpS2; sop |
UniProt ID | P31009 |
Protein Refseq | The length of the protein is 267 amino acids long. The sequence is show below: MADEAPARSGFRGGFGSRGGRGGRGRGRGRWARGRGKEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLGSTPYQAYSDFLSKPTPRLHADA. |
See other products for " RPS2 "
CBMOAB-40675FYC | Mouse Anti-RPS2 Antibody (CBMOAB-40675FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry