Mouse Anti-Rps2 Antibody (CBMOAB-30111FYA)


Cat: CBMOAB-30111FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-30111FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Frog (Xenopus laevis), Goat (Capra hircus), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Zebrafish (Danio rerio), Rhesus (Macaca mulatta), Maize (Zea mays), Rice (Oryza), Silkworm (Bombyx mori), Sugar beet (Beta vulgaris), Yeast WB, ELISA MO30111FYA 100 µg
CBMOAB-96524FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96524FYA 100 µg
CBMOAB-03608CR Monoclonal Yeast WB, ELISA MO03608CR 100 µg
CBMOAB-09366HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO09366HB 100 µg
CBMOAB-89235FYB Monoclonal Rice (Oryza) WB, ELISA MO89235FYB 100 µg
CBMOAB-60854FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60854FYC 100 µg
MO-AB-00567W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00567W 100 µg
MO-AB-38129W Monoclonal Goat (Capra hircus) WB, ELISA MO38129W 100 µg
MO-AB-43408W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43408W 100 µg
MO-AB-49498W Monoclonal Maize (Zea mays) WB, ELISA MO49498W 100 µg
MO-AB-70349W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70349W 100 µg
MO-AB-19557R Monoclonal Cattle (Bos taurus) WB, ELISA MO19557R 100 µg
MO-AB-07288H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07288C 100 µg
MO-AB-30531H Monoclonal Sugar beet (Beta vulgaris) WB, ELISA MO30531C 100 µg
MO-AB-01928L Monoclonal Bromus (Bromus vulgaris) WB, ELISA MO01928L 100 µg
MO-DKB-00888W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Zebrafish (Danio rerio), Rhesus (Macaca mulatta) WB, IF, IHC 100 µg
MO-DKB-02030W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg
MO-DKB-02251W Polyclonal A. thaliana (Arabidopsis thaliana) WB, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Barrel medic (Medicago truncatula), Bromus (Bromus vulgaris), C. elegans (Caenorhabditis elegans), Cattle (Bos taurus), Frog (Xenopus laevis), Goat (Capra hircus), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Zebrafish (Danio rerio), Rhesus (Macaca mulatta), Maize (Zea mays), Rice (Oryza), Silkworm (Bombyx mori), Sugar beet (Beta vulgaris), Yeast
CloneMO30111FYA
SpecificityThis antibody binds to fruit fly Rps2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S5P family of ribosomal proteins. It is located in the cytoplasm. This gene shares sequence similarity with mouse LLRep3. It is co-transcribed with the small nucleolar RNA gene U64, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Product OverviewMouse Anti-D. melanogaster Rps2 Antibody is a mouse antibody against Rps2. It can be used for Rps2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names40S ribosomal protein S2; Protein strings of pearls; RpS2; sop
UniProt IDP31009
Protein RefseqThe length of the protein is 267 amino acids long.
The sequence is show below: MADEAPARSGFRGGFGSRGGRGGRGRGRGRWARGRGKEDSKEWVPVTKLGRLVREGKIKSLEEIYLYSLPIKEFEIIDFFLGSSLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDNNGHIGLGVKCSKEVATAIRGAIILAKLSVVPVRRGYWGNKIGKPHTVPCKVTGKCGSVSVRLIPAPRGTGIVSAPVPKKLLTMAGIEDCYTSARGSTGTLGNFAKATYAAIAKTYAYLTPDLWKEMPLGSTPYQAYSDFLSKPTPRLHADA.
See other products for " RPS2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry