AibGenesis™ Mouse Anti-Rps3A Antibody (CBMOAB-30135FYA)
Cat: CBMOAB-30135FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-30135FYA | Monoclonal | Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Rice (Oryza), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO30135FYA | 100 µg | ||
| CBMOAB-40719FYC | Monoclonal | A. thaliana (Arabidopsis thaliana) | WB, ELISA | MO40719FC | 100 µg | ||
| CBMOAB-56833FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO56833FYA | 100 µg | ||
| CBMOAB-89245FYB | Monoclonal | Rice (Oryza) | WB, ELISA | MO89245FYB | 100 µg | ||
| CBMOAB-96549FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO96549FYA | 100 µg | ||
| MO-AB-01292L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01292L | 100 µg | ||
| MO-AB-03861Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03861Y | 100 µg | ||
| MO-AB-06853Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06853Y | 100 µg | ||
| MO-AB-08135W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08135W | 100 µg | ||
| MO-AB-09775Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09775Y | 100 µg | ||
| MO-AB-13086Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO13086Y | 100 µg | ||
| MO-AB-17522Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17522Y | 100 µg | ||
| MO-AB-19574R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19574R | 100 µg | ||
| MO-AB-28872R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28872R | 100 µg | ||
| MO-AB-33168W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33168W | 100 µg | ||
| MO-AB-33736H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33736C | 100 µg | ||
| MO-AB-35605W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35605W | 100 µg | ||
| MO-AB-38739W | Monoclonal | Gorilla | WB, ELISA | MO38739W | 100 µg | ||
| MO-AB-42491W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42491W | 100 µg | ||
| MO-AB-43409W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43409W | 100 µg | ||
| MO-AB-46384W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46384W | 100 µg | ||
| MO-AB-63576W | Monoclonal | Marmoset | WB, ELISA | MO63576W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Rice (Oryza), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO30135FYA |
| Specificity | This antibody binds to fruit fly Rps3A. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S3AE family of ribosomal proteins. It is located in the cytoplasm. Disruption of the gene encoding rat ribosomal protein S3a, also named v-fos transformation effector protein, in v-fos-transformed rat cells results in reversion of the transformed phenotype. This gene is co-transcribed with the U73A and U73B small nucleolar RNA genes, which are located in its fourth and third introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternatively spliced transcript variants have been found for this gene. (From uniprot, under CC BY 4.0) |
| Product Overview | Mouse Anti-D. melanogaster Rps3A Antibody is a mouse antibody against Rps3A. It can be used for Rps3A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | 40S ribosomal protein S3a; C3 protein; RpS3A; C3 M(4)101 |
| UniProt ID | P55830 |
| Protein Refseq | The length of the protein is 268 amino acids long. The sequence is show below: MAVGKNKGLSKGGKKGGKKKVVDPFSRKDWYDVKAPNMFQTRQIGKTLVNRTQGQRIASDYLKGRVFEVSLADLQKDIDPERSFRKFRLIAEDVQDRNVLCNFHGMDLTTDKYRSMVKKWQTLIEAIVEAKTVDGYLLRVFCIGFTAKDQQSQRKTCYAQQSQVRKIRARMTDIITNEVSGADLKQLVNKLALDSIAKDIEKSCQRIYPLHDVYIRKVKVLKKPRFDVSKLLELHGDGGGKSVEAVVSSEGAVIDRPEGYEPPVQEAV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry