Mouse Anti-rras Antibody (CBMOAB-96623FYA)


Cat: CBMOAB-96623FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-96623FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO96623FYA 100 µg
MO-AB-63612W Monoclonal Marmoset WB, ELISA MO63612W 100 µg
MO-AB-19603R Monoclonal Cattle (Bos taurus) WB, ELISA MO19603R 100 µg
MO-AB-28683H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28683C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus)
CloneMO96623FYA
SpecificityThis antibody binds to Zebrafish rras.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a small GTPase involved in diverse processes including angiogenesis, vascular homeostasis and regeneration, cell adhesion, and neuronal axon guidance. Mutations in this gene are found in many invasive cancers.
Product OverviewMouse Anti-Zebrafish rras Antibody is a mouse antibody against rras. It can be used for rras detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRelated RAS viral (R-ras) oncogene homolog; Rras protein; rra
UniProt IDQ4V9D8
Protein RefseqThe length of the protein is 196 amino acids long.
The sequence is show below: MSTEERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDILDTAGQEEFGAMREQYMRSGEGFLLVFALNDSGSYNEIQKFHTQILRVKDRDDFPMVLVGNKSDLDQQRVISKEEAMTFARENRIHYMESSAKNRHNVDEAFMEVVRAIRKFQETESPPLPANHTGKQKSGGCPCTLL.
See other products for " RRAS "
For Research Use Only | Not For Clinical Use.
Online Inquiry