AibGenesis™ Mouse Anti-RRP7A Antibody (CBMOAB-56896FYA)


Cat: CBMOAB-56896FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56896FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO56896FYA 100 µg
CBMOAB-96672FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96672FYA 100 µg
MO-AB-05739W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05739W 100 µg
MO-AB-07325H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07325C 100 µg
MO-AB-19613R Monoclonal Cattle (Bos taurus) WB, ELISA MO19613R 100 µg
MO-AB-25896W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25896W 100 µg
MO-AB-63630W Monoclonal Marmoset WB, ELISA MO63630W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Zebrafish (Danio rerio)
CloneMO56896FYA
SpecificityThis antibody binds to Rhesus RRP7A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RRP7A Antibody is a mouse antibody against RRP7A. It can be used for RRP7A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibosomal RNA-processing protein 7 homolog A; RRP7A
UniProt IDH9F5H8
Protein RefseqThe length of the protein is 278 amino acids long.
The sequence is show below: ARRRKSAARGPEDCIPSPPGYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSSCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYADSVPDPEALRVEVDTFMEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRARKELLNFYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY.
For Research Use Only | Not For Clinical Use.
Online Inquiry