Mouse Anti-RSPH1 Antibody (CBMOAB-56910FYA)


Cat: CBMOAB-56910FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56910FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset WB, ELISA MO56910FYA 100 µg
MO-AB-07332H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07332C 100 µg
MO-AB-19625R Monoclonal Cattle (Bos taurus) WB, ELISA MO19625R 100 µg
MO-AB-63645W Monoclonal Marmoset WB, ELISA MO63645W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset
CloneMO56910FYA
SpecificityThis antibody binds to Rhesus RSPH1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a male meiotic metaphase chromosome-associated acidic protein. This gene is expressed in tissues with motile cilia or flagella, including the trachea, lungs, airway brushings, and testes. Mutations in this gene result in primary ciliary dyskinesia-24. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus RSPH1 Antibody is a mouse antibody against RSPH1. It can be used for RSPH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRadial spoke head 1 homolog; RSPH1
UniProt IDH9F3E5
Protein RefseqThe length of the protein is 158 amino acids long.
The sequence is show below: LIHLNHRYQGKFLNKNPVGPGKYIFDVGCEQHGEYRLTDMERGEEEEEEELITVVPKWKATKITELALWTPALPKEPTSTDGPGQEGPGAESTGEPGEEAQALLEGFEGETDMRPGDEDADVLREESREYDQEEFRYDVDEGNINSEEEETRQLDLQD.
For Research Use Only | Not For Clinical Use.
Online Inquiry