Mouse Anti-RTFDC1 Antibody (CBMOAB-56940FYA)


Cat: CBMOAB-56940FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56940FYA Monoclonal Rhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO56940FYA 100 µg
CBMOAB-96752FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO96752FYA 100 µg
MO-AB-63668W Monoclonal Marmoset WB, ELISA MO63668W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset, Zebrafish (Danio rerio)
CloneMO56940FYA
SpecificityThis antibody binds to Rhesus RTFDC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RTFDC1 Antibody is a mouse antibody against RTFDC1. It can be used for RTFDC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRTFDC1
UniProt IDF7HJW9
Protein RefseqThe length of the protein is 305 amino acids long.
The sequence is show below: MGCDGGTIPKRHELVKGPKKVEKVDKDAELVAQWNYCTLSQEILRRPIVACELGRLYNKDAVIEFLLDKSSEKALGKAASHIKSIKNVTELKLSDNPAWEGDKGNTKGDKHDDLQRARFICPVVGLEMNGRHRFCFLRCCGCVFSERALKEIKAEVCHTCGAAFQEDDVIVLNGTKEDVDVLKARMEERRLRAKLEKKPQGHQKLRQGSLKKPALILERRKTTWLPKAQQQMRAFLEKLGSLCVEPQRGPSLTVKNPRPTSPSLPLTAPPSAPRRSPPTGSPTRPTASEAHNATAPAPEGCLVST.
For Research Use Only | Not For Clinical Use.
Online Inquiry