AibGenesis™ Mouse Anti-SAMD1 Antibody (CBMOAB-57081FYA)


Cat: CBMOAB-57081FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57081FYA Monoclonal Rhesus (Macaca mulatta), Rabbit (Oryctolagus cuniculus) WB, ELISA MO57081FYA 100 µg
MO-AB-09821Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09821Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rabbit (Oryctolagus cuniculus)
CloneMO57081FYA
SpecificityThis antibody binds to Rhesus SAMD1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SAMD1 Antibody is a mouse antibody against SAMD1. It can be used for SAMD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSAMD1
UniProt IDF7H230
Protein RefseqThe length of the protein is 302 amino acids long.
The sequence is show below: XGGAARAGGAARPVSLREVVRYLGGSGGAGGRLTRGRVQGLLEEEAAARGRLERTRLGALALPRGDRPGRAPPAASARQSRSKRGGEERVLEKEEEDDDDEDEDDEDDVSEGSEVPESDRPAGAHHHQLNGERGPQSAKERVKEWTPCGPHQGQDEGRAAPGSGTRQVFSMTGMNKEGGTASVATGPDSPSPVPLPPGKPALPGADGTPFGCPPGRKEKPSDPVEWTVMDVVEYFTEAGFPEQATAFQEQEIDGKSLLLMQRTDVLTGLSIRLGPALKIYEHHIKVLQQGHFEDDDPDGFLG.
For Research Use Only | Not For Clinical Use.
Online Inquiry