AibGenesis™ Mouse Anti-SAMD11 Antibody (CBMOAB-57088FYA)


Cat: CBMOAB-57088FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57088FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio) WB, ELISA MO57088FYA 100 µg
CBMOAB-97033FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97033FYA 100 µg
MO-AB-23999W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23999W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Zebrafish (Danio rerio)
CloneMO57088FYA
SpecificityThis antibody binds to Rhesus SAMD11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SAMD11 Antibody is a mouse antibody against SAMD11. It can be used for SAMD11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSterile alpha motif domain-containing protein 11; SAMD11
UniProt IDH9FG98
Protein RefseqThe length of the protein is 128 amino acids long.
The sequence is show below: SHDLLRVRQEVAASALRGPSGLEAHLPSSAAGQRRKQGLAQHREGAAPAVAPSFSERELPQPPPLLSPQNAPHIALGPHLRPPFLGVPSALCQTPGYGFLPPAQAEMFARQQELLRKQNLARLELPAD.
For Research Use Only | Not For Clinical Use.
Online Inquiry