AibGenesis™ Mouse Anti-SATL1 Antibody (CBMOAB-57139FYA)


Cat: CBMOAB-57139FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57139FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis) WB, ELISA MO57139FYA 100 µg
MO-AB-07421H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07421C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis)
CloneMO57139FYA
SpecificityThis antibody binds to Rhesus SATL1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SATL1 Antibody is a mouse antibody against SATL1. It can be used for SATL1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSATL1
UniProt IDF6Z7Z0
Protein RefseqThe length of the protein is 431 amino acids long.
The sequence is show below: MSPPGMWQPGISQQVPSHPDMSQPGMSQQQVPSQPVMRQPGTSQSCKNQTDMGQPGANQSSLSDSNQTGINQPSPSLHGVNQLNMNQLSASLYEMNQVDMKQPSMSQAGIRQSGTSLPDINQPGMKQPGTWQLGRSQPGMWPQSLNQLFLSKASISQPGPSQPGPSQSGPSQSSTSQAGTNRSGISQTVTWQLDRRQSGRSQPSMRQVGTNQSGTSQRVTWQTGPSQLARNRPNMSSPGMWQPGMSQQVPSQLGMRQPGTSQSRKNQTGMSHPGRGHPGIWEPGPSHPGRSQQELDQLVLSQPGLSQPGRSQPSVSQMGMRQTSMDYFQIRPAEAGDCPEILRLIKELAACESMLDAMELTAADLLRDGFGDNPLFYCLIAEVNEQQKPSGKLTVGFAMYYFTYDSWIGKVLYLEDFYVTRAYQGTHSDSQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry