AibGenesis™ Mouse Anti-SBK2 Antibody (CBMOAB-57144FYA)


Cat: CBMOAB-57144FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57144FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO57144FYA 100 µg
MO-AB-05799W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05799W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO57144FYA
SpecificityThis antibody binds to Rhesus SBK2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SBK2 Antibody is a mouse antibody against SBK2. It can be used for SBK2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSBK2
UniProt IDF6RUK7
Protein RefseqThe length of the protein is 311 amino acids long.
The sequence is show below: QGQEAARVLEDMMALSAQTLVRAEVDELYEEVRPLGQGRYGRVLLVTHRQKGTPLALKQLPKPHTSLRGFLYEFCVGLSLGVHSAIVTAYGIGIESAQSYSFLTEPVLHGDLMAFIQPKVGLPQPAVHRCAAQLASALEYIHARGLVYRDLKPENVLVCDPDCRHFKLTDFGHTRPRGTLLRLAGPPIPYTAPELCAPPPLPEGLPIQPALDAWALGVLVFCLLTGYFPWDQPLAEADPFYEDFLIWQASGQPQDRPQPWFGLAPAADALLWGLLDPHPRRRSAVSSIREHLGRPWRQREGEAEEVGGVEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry