AibGenesis™ Mouse Anti-Scp2 Antibody (CBMOAB-30443FYA)


Cat: CBMOAB-30443FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-30443FYA Monoclonal Fruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta) WB, ELISA MO30443FYA 100 µg
Inquiry
CBMOAB-41125FYC Monoclonal A. thaliana (Arabidopsis thaliana) WB, ELISA MO41125FC 100 µg
Inquiry
CBMOAB-57261FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO57261FYA 100 µg
Inquiry
MO-AB-03910Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03910Y 100 µg
Inquiry
MO-AB-07461H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07461C 100 µg
Inquiry
MO-AB-09855Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09855Y 100 µg
Inquiry
MO-AB-19818R Monoclonal Cattle (Bos taurus) WB, ELISA MO19818R 100 µg
Inquiry
MO-AB-24774W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24774W 100 µg
Inquiry
MO-AB-29006R Monoclonal Pig (Sus scrofa) WB, ELISA MO29006R 100 µg
Inquiry
MO-AB-63963W Monoclonal Marmoset WB, ELISA MO63963W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta)
CloneMO30443FYA
SpecificityThis antibody binds to fruit fly Scp2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes two proteins: sterol carrier protein X (SCPx) and sterol carrier protein 2 (SCP2), as a result of transcription initiation from 2 independently regulated promoters. The transcript initiated from the proximal promoter encodes the longer SCPx protein, and the transcript initiated from the distal promoter encodes the shorter SCP2 protein, with the 2 proteins sharing a common C-terminus. Evidence suggests that the SCPx protein is a peroxisome-associated thiolase that is involved in the oxidation of branched chain fatty acids, while the SCP2 protein is thought to be an intracellular lipid transfer protein. This gene is highly expressed in organs involved in lipid metabolism, and may play a role in Zellweger syndrome, in which cells are deficient in peroxisomes and have impaired bile acid synthesis. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Scp2 Antibody is a mouse antibody against Scp2. It can be used for Scp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCalcium-binding protein; Cex Ca2+-sensing low molecular weight GTPase; RH52364p; Sarcoplasmic calcium-binding protein 2; Scp2; SCP2
UniProt IDO16158
Protein RefseqThe length of the protein is 184 amino acids long.
The sequence is show below: MSISDFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVCQLRGWQKDTPKNKETYDLMMEIWTGLRSKADKDNDGQVSVDEWCNMWDAYAKDPSSVMDWQNAYMNFMFDLEDASHDGGIDVTEFTLVCSSYGLEKTECEEAFAKMSQGQSEVTREQFAALWKEYFAAEDVNAPGNYIFGKTSF.
For Research Use Only | Not For Clinical Use.
Online Inquiry