AibGenesis™ Mouse Anti-SCP2D1 Antibody (MO-AB-19819R)


Cat: MO-AB-19819R

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-19819R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO19819R 100 µg
MO-AB-28873H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28873C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO19819R
SpecificityThis antibody binds to Cattle SCP2D1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against SCP2D1. It can be used for SCP2D1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSCP2 sterol-binding domain-containing protein 1; SCP2D1
UniProt IDQ2TBS3
Protein RefseqThe length of the protein is 156 amino acids long.
The sequence is show below: MWKRIDHQLKIKAGDGPQAGQFKELGPGREPAVPHPLSLSEFQTVPVFEDISQHVKEVGSQLVKKVNAIFQLDITKDGKTVHQWTIDLKNGSGDTYRGPARLPADTVFTIPEPVFMELILGKMNPQKAFLAGKFKVSGKVLLGQKLERVFKDWAKW.
For Research Use Only | Not For Clinical Use.
Online Inquiry