Mouse Anti-SDCCAG3 Antibody (CBMOAB-57288FYA)


Cat: CBMOAB-57288FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57288FYA Monoclonal Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO57288FYA 100 µg
CBMOAB-97365FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97365FYA 100 µg
MO-AB-28883H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28883C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO57288FYA
SpecificityThis antibody binds to Rhesus SDCCAG3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSDCCAG3 (Serologically Defined Colon Cancer Antigen 3) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus SDCCAG3 Antibody is a mouse antibody against SDCCAG3. It can be used for SDCCAG3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSDCCAG3
UniProt IDF7DSA8
Protein RefseqThe length of the protein is 412 amino acids long.
The sequence is show below: MSGYPRRPGATPLSRVRSLAIPDAPAFYERRSCLPQLDCERPHGRDLDSPFFGIRPAFMCYVPSPVLASVGDTDDKFEDLEEANPFSFKEFLKTKNLGLSKEDPASRIYAKEASRHSLGLDHNSPPSQTGGYGLEYQQPFFEDPTGAGDLLDEEEDEDTGWSGAYLPSAIEQTHPERVRAGTSPCSTYLSFFSTPSELAGPESLPPWALSDTDSRVSPASPAGSPSADFAAHGESLGDRHLRTLQISYEALKDENSKLRRKLNEVQSFSEAQTEMVRTLERKLEAKMIKEESDYHDLESVVQQVEQNLELMTKRAVKAENHVVKLKQEISLLQAQVSNFQRENEALRCGQGASLTVVKQNADVALQNLRVVMNGAQASIKQLVSGAETLNLVAEILKSIDRISEIKDEEEDS.
For Research Use Only | Not For Clinical Use.
Online Inquiry