Mouse Anti-Sdhc Antibody (MO-AB-28890H)


Cat: MO-AB-28890H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-28890H Monoclonal Rat (Rattus norvegicus), Cattle (Bos taurus), Hamsters (Cricetinae), Horse (Equus caballus), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO28890C 100 µg
CBMOAB-57299FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO57299FYA 100 µg
CBMOAB-97387FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97387FYA 100 µg
MO-AB-43424W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43424W 100 µg
MO-AB-46487W Monoclonal Horse (Equus caballus) WB, ELISA MO46487W 100 µg
MO-AB-19860R Monoclonal Cattle (Bos taurus) WB, ELISA MO19860R 100 µg
MO-AB-29018R Monoclonal Pig (Sus scrofa) WB, ELISA MO29018R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Cattle (Bos taurus), Hamsters (Cricetinae), Horse (Equus caballus), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO28890C
SpecificityThis antibody binds to Rat Sdhc.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. There are several related pseudogenes for this gene on different chromosomes. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants have been described. (From NCBI)
Product OverviewThis product is a mouse antibody against Sdhc. It can be used for Sdhc detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Sdhc; Succinate dehydrogenase complex, subunit C, integral membrane protein; Succinate dehydrogenase complex, subunit C, integral membrane protein, isoform CRA_b; Sdhc
UniProt IDQ641Z9
Protein RefseqThe length of the protein is 169 amino acids long.
The sequence is show below: MAALLLRHIGRHCLRAHLSSQLCIRNAAPLGTTAKEEMARFWNKNTSSNRPVSPHLTIYRWSLPMAMSVCHRGSGIAMSGGVSLFGLSALLLPGNFESYLMLVKSLCLGPALIHAAKFVLVFPLMYHSLNGVRHLMWDLGKGLSISQVQLSGVTVLVLAVLSSAGLAAI.
See other products for " sdhC "
For Research Use Only | Not For Clinical Use.
Online Inquiry