Mouse Anti-Sdhc Antibody (MO-AB-28890H)
Cat: MO-AB-28890H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-28890H | Monoclonal | Rat (Rattus norvegicus), Cattle (Bos taurus), Hamsters (Cricetinae), Horse (Equus caballus), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO28890C | 100 µg | ||
| CBMOAB-57299FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO57299FYA | 100 µg | ||
| CBMOAB-97387FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO97387FYA | 100 µg | ||
| MO-AB-43424W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43424W | 100 µg | ||
| MO-AB-46487W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46487W | 100 µg | ||
| MO-AB-19860R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19860R | 100 µg | ||
| MO-AB-29018R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO29018R | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rat (Rattus norvegicus), Cattle (Bos taurus), Hamsters (Cricetinae), Horse (Equus caballus), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO28890C |
| Specificity | This antibody binds to Rat Sdhc. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes one of four nuclear-encoded subunits that comprise succinate dehydrogenase, also known as mitochondrial complex II, a key enzyme complex of the tricarboxylic acid cycle and aerobic respiratory chains of mitochondria. The encoded protein is one of two integral membrane proteins that anchor other subunits of the complex, which form the catalytic core, to the inner mitochondrial membrane. There are several related pseudogenes for this gene on different chromosomes. Mutations in this gene have been associated with paragangliomas. Alternatively spliced transcript variants have been described. |
| Product Overview | This product is a mouse antibody against Sdhc. It can be used for Sdhc detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein Sdhc; Succinate dehydrogenase complex, subunit C, integral membrane protein; Succinate dehydrogenase complex, subunit C, integral membrane protein, isoform CRA_b; Sdhc |
| UniProt ID | Q641Z9 |
| Protein Refseq | The length of the protein is 169 amino acids long. The sequence is show below: MAALLLRHIGRHCLRAHLSSQLCIRNAAPLGTTAKEEMARFWNKNTSSNRPVSPHLTIYRWSLPMAMSVCHRGSGIAMSGGVSLFGLSALLLPGNFESYLMLVKSLCLGPALIHAAKFVLVFPLMYHSLNGVRHLMWDLGKGLSISQVQLSGVTVLVLAVLSSAGLAAI. |
See other products for " sdhC "
| CBMOAB-2551YC | Mouse Anti-sdhC Antibody (CBMOAB-2551YC) |
| CBMOAB-30671FYA | Mouse Anti-Sdhc Antibody (CBMOAB-30671FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry