Mouse Anti-Wnt2 Antibody (MO-AB-14041Y)


Cat: MO-AB-14041Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-14041Y Monoclonal Sea-anemone, Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO14041Y 100 µg
CBMOAB-34403FYA Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO34403FYA 100 µg
CBMOAB-16309FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO16309FYB 100 µg
MO-AB-08781W Monoclonal Cat (Felis catus) WB, ELISA MO08781W 100 µg
MO-AB-20725W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20725W 100 µg
MO-AB-34061W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO34061W 100 µg
MO-AB-47079W Monoclonal Horse (Equus caballus) WB, ELISA MO47079W 100 µg
MO-AB-67910W Monoclonal Marmoset WB, ELISA MO67910W 100 µg
MO-AB-22982R Monoclonal Cattle (Bos taurus) WB, ELISA MO22982R 100 µg
MO-AB-31255R Monoclonal Pig (Sus scrofa) WB, ELISA MO31255R 100 µg
MO-AB-23892H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23892C 100 µg
MO-AB-30048H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO30048C 100 µg
MO-AB-34033H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO34033C 100 µg
MO-AB-01681L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01681L 100 µg
MO-AB-07005Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO07005Y 100 µg
MO-AB-10496Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO10496Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySea-anemone, Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO14041Y
SpecificityThis antibody binds to Sea-anemone Wnt2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Alternatively spliced transcript variants have been identified for this gene. (From NCBI)
Product OverviewThis product is a mouse antibody against Wnt2. It can be used for Wnt2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Wnt; Wnt2
UniProt IDQ5IHW2
Protein RefseqThe length of the protein is 351 amino acids long. The sequence is show below: MAPAKARLGLLVLLILLYFPRKTESHWWFISQVFALGAKVMCNSITGLISIQRQMCLDNPDVMVSIGKGAKLGVEECQHQFRDQRWNCSTVNGDATVFGKVMRRASRETAFVYAISSAGVVHEVTRSCSLGELKDCSCRNKKGRSRKGFEWGGCSDNIQYGLNFAKAFVDSREVEKDARALMNLHNNHVGRRVVKTNMSLDCKCHGVSGSCSVRTCWKSISSFRIVGQHLREKYTTAVQVTVGQSGGELTNAEVSYKKPSRDDLVYLEDSPNYCMVDSNTGSLGTSGRECNGSASDTTGACSLLCCGRGFNTIQIEEEYKCHCKFHWCCYVKCQTCRRTVDKHICKAPSQP.
See other products for " WNT2 "
For Research Use Only | Not For Clinical Use.
Online Inquiry