AibGenesis™ Mouse Anti-SEC22A Antibody (CBMOAB-57334FYA)


Cat: CBMOAB-57334FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57334FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO57334FYA 100 µg
CBMOAB-97429FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97429FYA 100 µg
MO-AB-05838W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05838W 100 µg
MO-AB-07486H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07486C 100 µg
MO-AB-19885R Monoclonal Cattle (Bos taurus) WB, ELISA MO19885R 100 µg
MO-AB-24223W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24223W 100 µg
MO-AB-46489W Monoclonal Horse (Equus caballus) WB, ELISA MO46489W 100 µg
MO-AB-64009W Monoclonal Marmoset WB, ELISA MO64009W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Zebrafish (Danio rerio)
CloneMO57334FYA
SpecificityThis antibody binds to Rhesus SEC22A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the member of the SEC22 family of vesicle trafficking proteins. This protein has similarity to rat SEC22 and may act in the early stages of the secretory pathway. (From NCBI)
Product OverviewMouse Anti-Rhesus SEC22A Antibody is a mouse antibody against SEC22A. It can be used for SEC22A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSEC22A
UniProt IDF7C9Z8
Protein RefseqThe length of the protein is 307 amino acids long.
The sequence is show below: MSMILSASVIRVRDGLPLSASTDYEQSTGMQECRKYFKMLSRKLAQLPDRCTLKTGHYNINFISSLGVSYMMLCTDNYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQTEIKLRPPYQISMCELGSANGVTSAFSVDCKGAGKISSAHQRLEPATLSGIVGFILSLLCGALNLIRGFHAIESLLQSDGDDFNYIIAFFLVTAACLYQCYLLVYYTGWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQGKAPDYDV.
For Research Use Only | Not For Clinical Use.
Online Inquiry