AibGenesis™ Mouse Anti-Set Antibody (CBMOAB-30821FYA)


Cat: CBMOAB-30821FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-30821FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO30821FYA 100 µg
MO-AB-05901W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05901W 100 µg
MO-AB-07559H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07559C 100 µg
MO-AB-13000W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13000W 100 µg
MO-AB-20008R Monoclonal Cattle (Bos taurus) WB, ELISA MO20008R 100 µg
MO-AB-46500W Monoclonal Horse (Equus caballus) WB, ELISA MO46500W 100 µg
MO-AB-64185W Monoclonal Marmoset WB, ELISA MO64185W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Rhesus (Macaca mulatta)
CloneMO30821FYA
SpecificityThis antibody binds to fruit fly Set.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene inhibits acetylation of nucleosomes, especially histone H4, by histone acetylases (HAT). This inhibition is most likely accomplished by masking histone lysines from being acetylated, and the consequence is to silence HAT-dependent transcription. The encoded protein is part of a complex localized to the endoplasmic reticulum but is found in the nucleus and inhibits apoptosis following attack by cytotoxic T lymphocytes. This protein can also enhance DNA replication of the adenovirus genome. Several transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Set Antibody is a mouse antibody against Set. It can be used for Set detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein SET; Set
UniProt IDP53997
Protein RefseqThe length of the protein is 269 amino acids long.
The sequence is show below: MSSVPKRAKLDGAPADGNTSAAAGNNEEESEALEQIDACQNEIDALNEKASEEILKVEQKYNKLRKPCYEKRSELVKRIPNFWVTSFINHPQVSGILDEEEEECLHALNKLEVEEFEDIKSGYRINFHFDENPYFENKVLTKEFHLNSAAASENGDWPASTSTPIKWKEGKNLLKLLLTKPYGNKKKRNSEYKTFFDWFSDNTDPVNDEIAELIKDDLWPNPLQYYLVPDIEVEPEDEEDNEDNDEEAFDDEDGEDGEGEEEEEDEDDK.
For Research Use Only | Not For Clinical Use.
Online Inquiry