AibGenesis™ Mouse Anti-SETD1B Antibody (CBMOAB-57515FYA)


Cat: CBMOAB-57515FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57515FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO57515FYA 100 µg
MO-AB-05915W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05915W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO57515FYA
SpecificityThis antibody binds to Rhesus SETD1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SETD1B Antibody is a mouse antibody against SETD1B. It can be used for SETD1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone-lysine N-methyltransferase SETD1B; SETD1B
UniProt IDH9FKC7
Protein RefseqThe length of the protein is 367 amino acids long.
The sequence is show below: PPPPPPPPVEPTKLPFKELDNQWPSEAIPPGPRGRDEVTEEYMELAKSRGPWRRPPKKRHEDLVPPAGSPELSPPQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPADTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCG.
For Research Use Only | Not For Clinical Use.
Online Inquiry