AibGenesis™ Mouse Anti-Sf2 Antibody (CBMOAB-30835FYA)


Cat: CBMOAB-30835FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-30835FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus) WB, ELISA MO30835FYA 100 µg
MO-AB-03941Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03941Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus)
CloneMO30835FYA
SpecificityThis antibody binds to fruit fly Sf2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Sf2 Antibody is a mouse antibody against Sf2. It can be used for Sf2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLD40489p; SF2; SR family splicing factor; SR family splicing factor SF2; SF2; p28/SF2
UniProt IDQ9V3W7
Protein RefseqThe length of the protein is 255 amino acids long.
The sequence is show below: MGSRNECRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTGLPASGSWQDLKDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRVREDSGDNDRGGGGGGSGGGGGGSGGGGSRDYRDRSRSRSFSSRPRRRGTPTYSPVRRQSYSRSRSRSNY.
For Research Use Only | Not For Clinical Use.
Online Inquiry