Mouse Anti-SFT2D1 Antibody (MO-AB-20043R)


Cat: MO-AB-20043R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-20043R Monoclonal Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO20043R 100 µg
CBMOAB-57574FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO57574FYA 100 µg
CBMOAB-97911FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97911FYA 100 µg
MO-AB-16178W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16178W 100 µg
MO-AB-07582H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07582C 100 µg
MO-AB-28945H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28945C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO20043R
SpecificityThis antibody binds to Cattle SFT2D1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against SFT2D1. It can be used for SFT2D1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSFT2 domain containing 1; SFT2D1
UniProt IDQ3SYY5
Protein RefseqThe length of the protein is 159 amino acids long.
The sequence is show below: MEKLRRVLSGQDDEEQGLTAQVLDASTLSFNTRLKWFAICFVSGIFFSILGTGLLWLPGGIKLFAVFYTFGNIAALASTCFLMGPVKQLKKMFETTRLLATVIMLLCFVLTLCAALWWHKKGLAVLFCILQFLSMTWYSLSYIPYARDAVIKCCSSLLS.
For Research Use Only | Not For Clinical Use.
Online Inquiry