AibGenesis™ Mouse Anti-SFT2D2 Antibody (CBMOAB-57575FYA)


Cat: CBMOAB-57575FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57575FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO57575FYA 100 µg
MO-AB-07583H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07583C 100 µg
MO-AB-14945W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14945W 100 µg
MO-AB-20044R Monoclonal Cattle (Bos taurus) WB, ELISA MO20044R 100 µg
MO-AB-28947H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28947C 100 µg
MO-AB-64249W Monoclonal Marmoset WB, ELISA MO64249W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO57575FYA
SpecificityThis antibody binds to Rhesus SFT2D2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SFT2D2 Antibody is a mouse antibody against SFT2D2. It can be used for SFT2D2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSFT2D2
UniProt IDF7H8M3
Protein RefseqThe length of the protein is 108 amino acids long.
The sequence is show below: MDKLKKVLSGQDTEDRSGLSEVVEASSLSWGTRIKGFIACFAIGILCSLLGTLLLWVPRKGLHLFAVFYTFGNIASIGSCVLHLPCVLPFGGITRDLHLSSAFCSLWH.
For Research Use Only | Not For Clinical Use.
Online Inquiry