AibGenesis™ Mouse Anti-SFT2D3 Antibody (CBMOAB-57577FYA)


Cat: CBMOAB-57577FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57577FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO57577FYA 100 µg
CBMOAB-97912FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO97912FYA 100 µg
MO-AB-11437W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11437W 100 µg
MO-AB-28949H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28949C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO57577FYA
SpecificityThis antibody binds to Rhesus SFT2D3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSFT2D3 (SFT2 Domain Containing 3) is a Protein Coding gene.
Product OverviewMouse Anti-Rhesus SFT2D3 Antibody is a mouse antibody against SFT2D3. It can be used for SFT2D3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSFT2D3
UniProt IDF7HM55
Protein RefseqThe length of the protein is 215 amino acids long.
The sequence is show below: MADLHRQLQEYLAQGKGGGPAAAEPLLAAGKAEEPGDGPAGAWLGRAGLPWTWARSPGEWAAAGPACLPSVSRGQRLAAGGGCLLLAALCFGLAALYAPVLLLRARKFALLWSLGSALALAGGALLRGGAACGRLLRCEEAPSRPALLYTAALGATLFAALGLRSTLLTVLGAGAQVAALLAALVGLLPWGGGTALRLALGRLGRGAGLTKVLPV.
For Research Use Only | Not For Clinical Use.
Online Inquiry