Mouse Anti-Sheep Atg9 Antibody (MO-AB-14283Y)
Cat: MO-AB-14283Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sheep (Ovis aries) |
Clone | MO14283Y |
Specificity | This antibody binds to Sheep Atg9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Golgi apparatus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Involved in autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation. Plays a key role in the organization of the preautophagosomal structure/phagophore assembly site (PAS), the nucleating site for formation of the sequestering vesicle. |
Product Overview | This product is a mouse antibody against Atg9. It can be used for Atg9 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Autophagy-related protein 9; Atg9 |
UniProt ID | H6W900 |
Protein Refseq | The length of the protein is 72 amino acids long. The sequence is show below: DVLAVEHVLTTVTLLGVTVTVCRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQY. |
See other products for " atg9 "
MO-AB-31070H | Mouse Anti-Soybean atg9 Antibody (MO-AB-31070H) |
MO-DKB-0066RA | Rabbit Anti-ATG9 Antibody (MO-DKB-0066RA) |
MO-AB-00209Y | Mouse Anti-Chicken ATG9 Antibody (MO-AB-00209Y) |
MO-AB-00103R | Mouse Anti-Medaka atg9 Antibody (MO-AB-00103R) |
MO-AB-47425W | Mouse Anti-Maize atg9 Antibody (MO-AB-47425W) |
MO-DKB-0065RA | Rabbit Anti-ATG9 Antibody (MO-DKB-0065RA) |
CBMOAB-00758HCB | Mouse Anti-C. elegans ATG9 Antibody (CBMOAB-00758HCB) |
CBMOAB-02016FYA | Mouse Anti-D. melanogaster Atg9 Antibody (CBMOAB-02016FYA) |
CBMOAB-00396CR | Mouse Anti-Yeast ATG9 Antibody (CBMOAB-00396CR) |
For Research Use Only | Not For Clinical Use.
Online Inquiry