Mouse Anti-Sheep Drd1 Antibody (MO-AB-15111Y)
Cat: MO-AB-15111Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sheep (Ovis aries) |
Clone | MO15111Y |
Specificity | This antibody binds to Sheep Drd1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. Alternate transcription initiation sites result in two transcript variants of this gene. [provided by RefSeq, Jul 2008] |
Product Overview | This product is a mouse antibody against Drd1. It can be used for Drd1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Dopamine D1 receptor; Drd1 |
UniProt ID | F2WVH2 |
Protein Refseq | The length of the protein is 90 amino acids long. The sequence is show below: AIETVSINNNGAVVFSSHHEPRGSISKDCNVVYLIPHAVGSSEGLKKEEAGGIAKPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT. |
See other products for " DRD1 "
MO-AB-54500W | Mouse Anti-Marmoset DRD1 Antibody (MO-AB-54500W) |
MO-DKB-00615W | Rabbit Anti-DRD1 Antibody (MO-DKB-00615W) |
MO-AB-11680R | Mouse Anti-Cattle DRD1 Antibody (MO-AB-11680R) |
MO-AB-00419H | Mouse Anti-Arabidopsis DRD1 Antibody (MO-AB-00419H) |
MO-AB-23007W | Mouse Anti-Chimpanzee DRD1 Antibody (MO-AB-23007W) |
MO-AB-25465R | Mouse Anti-Pig DRD1 Antibody (MO-AB-25465R) |
MO-DKB-01053W | Rabbit Anti-DRD1 Antibody (MO-DKB-01053W) |
CBMOAB-27845FYC | Mouse Anti-Arabidopsis DRD1 Antibody (CBMOAB-27845FYC) |
MO-AB-07928Y | Mouse Anti-Rabbit DRD1 Antibody (MO-AB-07928Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry