Mouse Anti-Sheep eif4G2 Antibody (MO-AB-15153Y)
Cat: MO-AB-15153Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sheep (Ovis aries) |
Clone | MO15153Y |
Specificity | This antibody binds to Sheep eif4G2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. |
Product Overview | This product is a mouse antibody against eif4G2. It can be used for eif4G2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Eukaryotic translation initiation factor 4-gamma; eif4G2 |
UniProt ID | W6JX87 |
Protein Refseq | The length of the protein is 34 amino acids long. The sequence is show below: KLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIA. |
See other products for " EIF4G2 "
MO-AB-01734Y | Mouse Anti-Chicken EIF4G2 Antibody (MO-AB-01734Y) |
CBMOAB-41644FYA | Mouse Anti-Rhesus EIF4G2 Antibody (CBMOAB-41644FYA) |
MO-AB-11943R | Mouse Anti-Cattle EIF4G2 Antibody (MO-AB-11943R) |
MO-AB-07994Y | Mouse Anti-Rabbit EIF4G2 Antibody (MO-AB-07994Y) |
CBMOAB-16107FYA | Mouse Anti-D. melanogaster Eif4G2 Antibody (CBMOAB-16107FYA) |
MO-AB-03246H | Mouse Anti-Frog eif4g2 Antibody (MO-AB-03246H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry