Mouse Anti-Sheep eif4G2 Antibody (MO-AB-15153Y)


Cat: MO-AB-15153Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySheep (Ovis aries)
CloneMO15153Y
SpecificityThis antibody binds to Sheep eif4G2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionTranslation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
Product OverviewThis product is a mouse antibody against eif4G2. It can be used for eif4G2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesEukaryotic translation initiation factor 4-gamma; eif4G2
UniProt IDW6JX87
Protein RefseqThe length of the protein is 34 amino acids long. The sequence is show below: KLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIA.
For Research Use Only | Not For Clinical Use.
Online Inquiry