Mouse Anti-Sheep Fzd2 Antibody (MO-AB-15319Y)
Cat: MO-AB-15319Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Sheep (Ovis aries) |
| Clone | MO15319Y |
| Specificity | This antibody binds to Sheep Fzd2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. This gene encodes a protein that is coupled to the beta-catenin canonical signaling pathway. Competition between the wingless-type MMTV integration site family, member 3A and wingless-type MMTV integration site family, member 5A gene products for binding of this protein is thought to regulate the beta-catenin-dependent and -independent pathways. |
| Product Overview | This product is a mouse antibody against Fzd2. It can be used for Fzd2 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Frizzled 2; Fzd2 |
| UniProt ID | Q30DT6 |
| Protein Refseq | The length of the protein is 68 amino acids long. The sequence is show below: CVFSGLYTVPATILIPCYFYEQAFREHWERSWVSQHCKSLAIPCPPHYTPRMSPDFTVYMIKYLMTLI. |
See other products for " FZD2 "
| MO-AB-22496W | Mouse Anti-Chimpanzee FZD2 Antibody (MO-AB-22496W) |
| CBMOAB-43257FYA | Mouse Anti-Rhesus FZD2 Antibody (CBMOAB-43257FYA) |
| MO-AB-25964R | Mouse Anti-Pig FZD2 Antibody (MO-AB-25964R) |
| CBMOAB-77312FYA | Mouse Anti-Zebrafish fzd2 Antibody (CBMOAB-77312FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry