Mouse Anti-Sheep ODC1 Antibody (MO-AB-16384Y)


Cat: MO-AB-16384Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySheep (Ovis aries)
CloneMO16384Y
SpecificityThis antibody binds to Sheep ODC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified.
Product OverviewThis product is a mouse antibody against ODC1. It can be used for ODC1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesOrnithine decarboxylase 1; ODC1
UniProt IDB6EBJ8
Protein RefseqThe length of the protein is 67 amino acids long. The sequence is show below: GGGFPGSEDVKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVLKEQT.
For Research Use Only | Not For Clinical Use.
Online Inquiry