Mouse Anti-Sheep ODC1 Antibody (MO-AB-16384Y)
Cat: MO-AB-16384Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sheep (Ovis aries) |
Clone | MO16384Y |
Specificity | This antibody binds to Sheep ODC1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. |
Product Overview | This product is a mouse antibody against ODC1. It can be used for ODC1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ornithine decarboxylase 1; ODC1 |
UniProt ID | B6EBJ8 |
Protein Refseq | The length of the protein is 67 amino acids long. The sequence is show below: GGGFPGSEDVKLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKLVLKEQT. |
See other products for " ODC1 "
CBMOAB-35039FYB | Mouse Anti-Rice ODC1 Antibody (CBMOAB-35039FYB) |
MO-AB-60554W | Mouse Anti-Marmoset ODC1 Antibody (MO-AB-60554W) |
CBMOAB-53296FYA | Mouse Anti-Rhesus ODC1 Antibody (CBMOAB-53296FYA) |
CBMOAB-26425FYA | Mouse Anti-D. melanogaster Odc1 Antibody (CBMOAB-26425FYA) |
MO-AB-17115R | Mouse Anti-Cattle ODC1 Antibody (MO-AB-17115R) |
CBMOAB-08000HCB | Mouse Anti-C. elegans ODC1 Antibody (CBMOAB-08000HCB) |
MO-AB-03262Y | Mouse Anti-Chicken ODC1 Antibody (MO-AB-03262Y) |
MO-AB-23550H | Mouse Anti-Mallard ODC1 Antibody (MO-AB-23550H) |
CBMOAB-90473FYA | Mouse Anti-Zebrafish odc1 Antibody (CBMOAB-90473FYA) |
MO-AB-27902R | Mouse Anti-Pig ODC1 Antibody (MO-AB-27902R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry