Mouse Anti-Sheep SDHA Antibody (MO-AB-17579Y)
Cat: MO-AB-17579Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sheep (Ovis aries) |
Clone | MO17579Y |
Specificity | This antibody binds to Sheep SDHA. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes the major catalytic subunit of ubiquinone succinate oxidoreductase, a complex of the mitochondrial respiratory chain. This complex consists of four nuclear-encoded subunits and is located in the inner mitochondrial membrane. Mutations in this gene are associated with a defect in the mitochondrial respiratory chain called Leigh syndrome. A pseudogene has been identified on chromosome 3q29. This gene has been found to encode alternatively spliced transcript variants of different isoforms. [Provided by RefSeq, June 2014] |
Product Overview | This product is a mouse antibody against SDHA. It can be used for SDHA detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Succinate dehydrogenase complex subunit A flavoprotein; SDHA |
UniProt ID | A3QP72 |
Protein Refseq | The length of the protein is 42 amino acids long. The sequence is show below: QQKKPFEQHWRKHTLSYVDVKTGEVTLEYRPVIDRTLNETDC. |
See other products for " SDHA "
MO-NAB-00377W | Rabbit Anti-SDHA Antibody |
CBMOAB-30664FYA | Mouse Anti-D. melanogaster Sdha Antibody (CBMOAB-30664FYA) |
MO-AB-09864Y | Mouse Anti-Rabbit SDHA Antibody (MO-AB-09864Y) |
CBMOAB-57297FYA | Mouse Anti-Rhesus SDHA Antibody (CBMOAB-57297FYA) |
MO-AB-24567W | Mouse Anti-Chimpanzee SDHA Antibody (MO-AB-24567W) |
CBMOAB-00302FYA | Rabbit Anti-Mouse SDHA Antibody (CBMOAB-00302FYA) |
MO-AB-33263W | Mouse Anti-Dog SDHA Antibody (MO-AB-33263W) |
MO-AB-46483W | Mouse Anti-Horse SDHA Antibody (MO-AB-46483W) |
MO-AB-29015R | Mouse Anti-Pig SDHA Antibody (MO-AB-29015R) |
MO-DKB-03638W | Rabbit Anti-SDHA (AA 550-650, clone ms2109-046) Antibody (Cat MO-DKB-03638W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry