Mouse Anti-Sheep SMO Antibody (MO-AB-17730Y)
Cat: MO-AB-17730Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Sheep (Ovis aries) |
Clone | MO17730Y |
Specificity | This antibody binds to Sheep SMO. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein complex. |
Product Overview | This product is a mouse antibody against SMO. It can be used for SMO detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Smoothened; SMO |
UniProt ID | Q30DQ0 |
Protein Refseq | The length of the protein is 67 amino acids long. The sequence is show below: DGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKINET. |
See other products for " Smo "
CBMOAB-31340FYA | Mouse Anti-D. melanogaster Smo Antibody (CBMOAB-31340FYA) |
MO-AB-64932W | Mouse Anti-Marmoset SMO Antibody (MO-AB-64932W) |
CBMOAB-58549FYA | Mouse Anti-Rhesus SMO Antibody (CBMOAB-58549FYA) |
MO-AB-07851H | Mouse Anti-Frog smo Antibody (MO-AB-07851H) |
MO-AB-46619W | Mouse Anti-Horse SMO Antibody (MO-AB-46619W) |
CBMOAB-06536FYB | Mouse Anti-Zebrafish smo Antibody (CBMOAB-06536FYB) |
MO-NAB-00850W | Mouse Anti-Drosophila smo Antibody (AA 1-257) |
For Research Use Only | Not For Clinical Use.
Online Inquiry