Mouse Anti-WNT1 Antibody (MO-AB-18251Y)


Cat: MO-AB-18251Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-18251Y Monoclonal Sheep (Ovis aries), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO18251Y 100 µg
CBMOAB-62409FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO62409FYA 100 µg
CBMOAB-16294FYB Monoclonal Zebrafish (Danio rerio) WB, ELISA MO16294FYB 100 µg
MO-AB-08468W Monoclonal Cat (Felis catus) WB, ELISA MO08468W 100 µg
MO-AB-17976W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17976W 100 µg
MO-AB-34055W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO34055W 100 µg
MO-AB-35979W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35979W 100 µg
MO-AB-42849W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO42849W 100 µg
MO-AB-47074W Monoclonal Horse (Equus caballus) WB, ELISA MO47074W 100 µg
MO-AB-67905W Monoclonal Marmoset WB, ELISA MO67905W 100 µg
MO-AB-22975R Monoclonal Cattle (Bos taurus) WB, ELISA MO22975R 100 µg
MO-AB-31247R Monoclonal Pig (Sus scrofa) WB, ELISA MO31247R 100 µg
MO-AB-34028H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO34028C 100 µg
MO-AB-01673L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01673L 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySheep (Ovis aries), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO18251Y
SpecificityThis antibody binds to Sheep WNT1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is very conserved in evolution, and the protein encoded by this gene is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. This gene is clustered with another family member, WNT10B, in the chromosome 12q13 region. (From NCBI)
Product OverviewThis product is a mouse antibody against WNT1. It can be used for WNT1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Wnt; WNT1
UniProt IDW5QCM0
Protein RefseqThe length of the protein is 366 amino acids long. The sequence is show below: MGHWALLPCWVSAALLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVMEPRLQLLSRKKRRVSPQKPSVSGGLQSAVRECKWQFRNRRWNCPTASGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGNNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCPFHWCCHVSCRNCTHTRILHECL.
See other products for " WNT1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry