AibGenesis™ Mouse Anti-WNT1 Antibody (MO-AB-10489Y)
Cat: MO-AB-10489Y

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-10489Y | Monoclonal | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO10489Y | 100 µg | ||
| CBMOAB-62409FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO62409FYA | 100 µg | ||
| CBMOAB-16294FYB | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO16294FYB | 100 µg | ||
| MO-AB-08468W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08468W | 100 µg | ||
| MO-AB-17976W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17976W | 100 µg | ||
| MO-AB-34055W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO34055W | 100 µg | ||
| MO-AB-35979W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35979W | 100 µg | ||
| MO-AB-42849W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO42849W | 100 µg | ||
| MO-AB-47074W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO47074W | 100 µg | ||
| MO-AB-67905W | Monoclonal | Marmoset | WB, ELISA | MO67905W | 100 µg | ||
| MO-AB-22975R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO22975R | 100 µg | ||
| MO-AB-31247R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO31247R | 100 µg | ||
| MO-AB-34028H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO34028C | 100 µg | ||
| MO-AB-01673L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01673L | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rabbit (Oryctolagus cuniculus), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO10489Y |
| Specificity | This antibody binds to Rabbit WNT1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Extracellular region or secreted; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is very conserved in evolution, and the protein encoded by this gene is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. This gene is clustered with another family member, WNT10B, in the chromosome 12q13 region. (From NCBI) |
| Product Overview | This product is a mouse antibody against WNT1. It can be used for WNT1 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein Wnt; WNT1 |
| UniProt ID | G1U5M0 |
| Protein Refseq | The length of the protein is 362 amino acids long. The sequence is show below: MPPRPCLPDQTSSDLFSAPPAIPHLLRGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTTGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL. |
See other products for " WNT1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry