Mouse Anti-Shf Antibody (CBMOAB-30986FYA)


Cat: CBMOAB-30986FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-30986FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO30986FYA 100 µg
CBMOAB-57711FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO57711FYA 100 µg
MO-AB-20103R Monoclonal Cattle (Bos taurus) WB, ELISA MO20103R 100 µg
MO-AB-28969H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28969C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO30986FYA
SpecificityThis antibody binds to fruit fly Shf.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-D. melanogaster Shf Antibody is a mouse antibody against Shf. It can be used for Shf detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesShifted, isoform B; shf
UniProt IDX2JED7
Protein RefseqThe length of the protein is 460 amino acids long.
The sequence is show below: MTHQGIGCLVKWLYLVLIVHTLLCIGQLECRQQHHNRNNNNNNRRADSSSSEEGHGNTSDGLDNFADQDASFVGHGHQPRRGQRKKQQGGGGGGSGGGGGNGGGGGSRHNRNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRVTNDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSGRIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKECAHRGVYDIDASNPTSLTTLQAPDPECSLKCGKNGYCNEHHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSVCTCPEGYQGTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCRCPNGLRGDHCEIGRKQRSICKCRNGTCVSHKHCKCHPGFYGRHCNGRKRRHVHRNDDSKF.
For Research Use Only | Not For Clinical Use.
Online Inquiry