Mouse Anti-SHISA7 Antibody (CBMOAB-57721FYA)


Cat: CBMOAB-57721FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-57721FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis) WB, ELISA MO57721FYA 100 µg
MO-AB-07618H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07618C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis)
CloneMO57721FYA
SpecificityThis antibody binds to Rhesus SHISA7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus SHISA7 Antibody is a mouse antibody against SHISA7. It can be used for SHISA7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein shisa-7; SHISA7
UniProt IDH9F6H2
Protein RefseqThe length of the protein is 95 amino acids long.
The sequence is show below: RASLAASHSNLLLGPGGPPTPLRGLPPPSSLHAPHHHALHGSPQPAWMSDAGGGGGTLARRPPFQRQGTLEQLQFIPGHHLPQHLRTASKNEVTV.
For Research Use Only | Not For Clinical Use.
Online Inquiry