Mouse Anti-siah2 Antibody (MO-AB-07628H)
Cat: MO-AB-07628H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-07628H | Monoclonal | Frog (Xenopus laevis), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Human (Homo sapiens), Pig (Sus scrofa), Fruit fly (Drosophila melanogaster), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO07628C | 100 µg | ||
MO-NAB-00099W | Monoclonal | Human (Homo sapiens), Pig (Sus scrofa), Fruit fly (Drosophila melanogaster) | WB, FC, FC-IC, IF, IHC, IHC-Fr, IHC-P | 24E6H3 | 100 µg | ||
MO-AB-24503W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24503W | 100 µg | ||
MO-AB-33323W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO33323W | 100 µg | ||
MO-AB-35668W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35668W | 100 µg | ||
MO-AB-46519W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46519W | 100 µg | ||
MO-AB-64377W | Monoclonal | Marmoset | WB, ELISA | MO64377W | 100 µg | ||
MO-AB-20121R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20121R | 100 µg | ||
MO-AB-01360L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO01360L | 100 µg | ||
MO-AB-03958Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO03958Y | 100 µg | ||
MO-AB-09918Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO09918Y | 100 µg | ||
MO-AB-17632Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17632Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Frog (Xenopus laevis), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Human (Homo sapiens), Pig (Sus scrofa), Fruit fly (Drosophila melanogaster), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
Clone | MO07628C |
Specificity | This antibody binds to Frog siah2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in regulating cellular response to hypoxia. (From NCBI) |
Product Overview | This product is a mouse antibody against siah2. It can be used for siah2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | E3 ubiquitin-protein ligase; EC 6.3.2.-; siah2; siah2-A |
UniProt ID | B7ZS60 |
Protein Refseq | The length of the protein is 313 amino acids long. The sequence is show below: MSRPSSAGPCASKPCGKQKQPPPPPPHAPSLPATISGGPGASAPPAPTAAAITGPLSQQHQELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRASLTPSIRNLAMEKVASAVLFPCKYASTGCSLSLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLENVMQHLTHSHKSITTLQGEDIVFLATDINLPGAVDWVMMQYCFNHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENYAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry