Mouse Anti-siah2 Antibody (MO-AB-07628H)


Cat: MO-AB-07628H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07628H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Human (Homo sapiens), Pig (Sus scrofa), Fruit fly (Drosophila melanogaster), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO07628C 100 µg
MO-NAB-00099W Monoclonal Human (Homo sapiens), Pig (Sus scrofa), Fruit fly (Drosophila melanogaster) WB, FC, FC-IC, IF, IHC, IHC-Fr, IHC-P 24E6H3 100 µg
MO-AB-24503W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24503W 100 µg
MO-AB-33323W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO33323W 100 µg
MO-AB-35668W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35668W 100 µg
MO-AB-46519W Monoclonal Horse (Equus caballus) WB, ELISA MO46519W 100 µg
MO-AB-64377W Monoclonal Marmoset WB, ELISA MO64377W 100 µg
MO-AB-20121R Monoclonal Cattle (Bos taurus) WB, ELISA MO20121R 100 µg
MO-AB-01360L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO01360L 100 µg
MO-AB-03958Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03958Y 100 µg
MO-AB-09918Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO09918Y 100 µg
MO-AB-17632Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17632Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Horse (Equus caballus), Human (Homo sapiens), Pig (Sus scrofa), Fruit fly (Drosophila melanogaster), Marmoset, Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO07628C
SpecificityThis antibody binds to Frog siah2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is a member of the seven in absentia homolog (SIAH) family. The protein is an E3 ligase and is involved in ubiquitination and proteasome-mediated degradation of specific proteins. The activity of this ubiquitin ligase has been implicated in regulating cellular response to hypoxia. (From NCBI)
Product OverviewThis product is a mouse antibody against siah2. It can be used for siah2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesE3 ubiquitin-protein ligase; EC 6.3.2.-; siah2; siah2-A
UniProt IDB7ZS60
Protein RefseqThe length of the protein is 313 amino acids long.
The sequence is show below: MSRPSSAGPCASKPCGKQKQPPPPPPHAPSLPATISGGPGASAPPAPTAAAITGPLSQQHQELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRASLTPSIRNLAMEKVASAVLFPCKYASTGCSLSLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLENVMQHLTHSHKSITTLQGEDIVFLATDINLPGAVDWVMMQYCFNHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENYAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP.
For Research Use Only | Not For Clinical Use.
Online Inquiry