Mouse Anti-Silkworm A3 Antibody (MO-AB-68720W)
Cat: MO-AB-68720W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Silkworm (Bombyx mori) |
Clone | MO68720W |
Specificity | This antibody binds to Silkworm A3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes. Required for assembly and activity of the V-ATPase. |
Product Overview | Mouse Anti-Silkworm A3 Antibody is a mouse antibody against A3. It can be used for A3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Cytoplasmic actin; A3 |
UniProt ID | Q6AW41 |
Protein Refseq | The length of the protein is 53 amino acids long. The sequence is show below: MCDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDS. |
See other products for " a3 "
CBMOAB-18451FYB | Mouse Anti-Rice a3 Antibody (CBMOAB-18451FYB) |
MO-AB-00007Y | Mouse Anti-Chicken a3 Antibody (MO-AB-00007Y) |
CBMOAB-1183FYC | Mouse Anti-Arabidopsis A3 Antibody (CBMOAB-1183FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry